<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15496
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADSQDPNQSRTALAGRLPDPPPFWKSFTDQNMARIKKLQEAMPAAHPNGSSLLMRLEGLSPDLLYLQPPAEPPNSEWRVFGNKYTLDDKLPSLEEQGMDRLVPKQEDDANSKDIKHLDRAFELKRLAKSVLLNFLELMGQLSIDPKFAEAKVDDIRTLFINFHHVLNEYRPHQAREQAISLMQDRLDKIRAETTAINAQMDKAKRVLDGLASIDVPNVEAAMAEMSPVRVDKEEVLKQRDTEIWQHADMLLGLA |
| Length | 255 |
| Position | Middle |
| Organism | Ceratocystis fimbriata CBS 114723 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Microascales> Ceratocystidaceae> Ceratocystis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.557 |
| Instability index | 40.21 |
| Isoelectric point | 5.35 |
| Molecular weight | 28958.75 |
| Publications | PubMed=23931120
PubMed=24563841
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.96| 34| 67| 5| 41| 1
---------------------------------------------------------------------------
5- 41 (55.92/40.53) QDPNQSRTALAGR..LPDPPPfwkSFTDQNMARIKKLQE
72- 107 (57.04/32.51) EPPNSEWRVFGNKytLDDKLP...SLEEQGMDRLVPKQE
---------------------------------------------------------------------------
|