<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15483

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSHIPPSSSSHAGPPPSPSSPAVDTAKSHQVHQQNRPKDQTPHTPTSPLMSVSTQNYASSFSTTQTSPAQTLQPASLSSPPSSIAMSTQVSQQPTVTSTTSFPTPASSVGGHFANNPTMDEAESTSKNATAGPRKDGESFMGKESGLDFMDIDTSGHRRTDHDRQKKGSGRNLDENTMDLDYRAASSLQEEDLSLAALQQDIGAAFHLCKSSYTASGPNPSLDLVSLYGLGPVAASVARTDPVTGEKINRLRKSYEGKIKGLGLAGRNKPVKAEPGAPGGLRYLTLWPEEEWQNQKVYGKDIKVAEPDSAFFRQQLKAMKMEPGTLPNHEFWEDALGHEKPVKVIAATDLSMGKTAGPFPGPVRQPMHTNGSPPMISTPTTENTRPKRSGKKRSYNDSSFVGYGEGFPDDEADLESGRYSNSEEGGRGQGKKKRKKDHISGVSPTLTERSGSYGVGMFGVGAR
Length463
PositionHead
OrganismEmmonsia crescens
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia.
Aromaticity0.06
Grand average of hydropathy-0.817
Instability index52.01
Isoelectric point8.36
Molecular weight49543.27
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.36|      20|      24|      16|      35|       1
---------------------------------------------------------------------------
   16-   35 (36.98/19.04)	PSPSSPAVDTAKSHQVHQQN
   37-   56 (33.79/16.74)	PKDQTPHTPTSPLMSVSTQN
   75-   93 (26.59/11.54)	ASLSSPPSSIAMSTQVSQQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.22|      24|      25|     130|     153|       2
---------------------------------------------------------------------------
  130-  153 (45.45/30.64)	TAGPRKDGESFMGKESG..LD..FMDID
  154-  181 (35.77/22.40)	TSGHRRTDHDRQKKGSGrnLDenTMDLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.68|      16|     223|     216|     231|       3
---------------------------------------------------------------------------
  216-  231 (30.40/17.78)	SGPNPSLDLVS.LYGLG
  440-  456 (25.28/13.59)	SGVSPTLTERSgSYGVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.87|      38|      42|     252|     289|       6
---------------------------------------------------------------------------
  252-  289 (66.92/31.68)	RKSYEGKIKGLGLAGR..NKPVKAEPGAPGGLRYLTLWPE
  295-  334 (62.95/29.46)	QKVYGKDIKVAEPDSAffRQQLKAMKMEPGTLPNHEFWED
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15483 with Med19 domain of Kingdom Fungi
Unable to open file!