<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15462
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLCYLSAYHDHSAAIRPSNIPTAIPQLNKIPKNPSPATPAGAGGSATPGPASSGGGGGGAASPPQQQQPTTPAPESQHQQQQSPTDPAPDDPQTFAQRQRELARDLIIKEQQIEYLISVLPGIDSSEAEQEARIKALADELRVVEAQRRLKRKELRRLGERLDDVLGAVGRGVRC |
Length | 196 |
Position | Middle |
Organism | Polytolypa hystricis UAMH7299 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Polytolypa.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.589 |
Instability index | 71.85 |
Isoelectric point | 5.93 |
Molecular weight | 21019.30 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15462
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.41| 10| 32| 52| 61| 1
---------------------------------------------------------------------------
52- 61 (20.39/ 9.53) PKNPSPATPA
85- 94 (20.02/ 9.23) PQQQQPTTPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.99| 26| 32| 108| 133| 2
---------------------------------------------------------------------------
108- 133 (45.06/28.02) PAPDDPQTFAQ.RQRELARDLIIKEQQ
142- 168 (36.93/21.79) PGIDSSEAEQEaRIKALADELRVVEAQ
---------------------------------------------------------------------------
|