<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15460
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSHVPSSSSFQAGTPPSPSSPPADSAKTHQLHQQHRAKDQTPHTPTSPPLMSVGAQNYASSFSTTQTSPAQTLHSAPLSSPPSSVAMSTQVSQQPTVTSTTSFPTPASSVGGHFTGNNTMDEPEGTAKNVSADSRKDGGSFTSKESGSDFMDVDVSGHRRTDHDRQKGGFRGNLDENAMDLDYRAASSTQEEQLSLSALQQDIGTAFHLCKSSYTTSGPNPSLDLVSLYGLGPVAASVARTDPVTGEKINRLRKSYEGKIKGLCLAGRNKPVKAEPGAPGGLKYLTLWPEEEWQNQKVYGKEIKVAEPESSFLKQQLKAMKLEPGTLPNHEFWEDALGHEKPSKVAPGTGTDAKTVGTLPGQVRRPNQANGAYPSVSTPVAENTRPKRTGKKRSYNDSSFVGYGEGFPDDDGDIDSGIYSNSEEGGRGQGKKKRKKDHISGVSPTLTERGGSYGVGMFGVGAR |
Length | 463 |
Position | Head |
Organism | Helicocarpus griseus UAMH5409 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Helicocarpus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.817 |
Instability index | 46.97 |
Isoelectric point | 8.28 |
Molecular weight | 49209.58 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15460
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 138.80| 26| 26| 65| 90| 1
---------------------------------------------------------------------------
14- 30 (26.24/10.46) ..TPP........SP.SSPPADS.....A...KTHQ
32- 63 (33.58/15.75) HQQHRAkdQTPHT.PTSPPLMSVgaqnyA...SSFS
65- 90 (47.43/25.71) TQTSPA..QTLHSAPLSSPPSSV.....A...MSTQ
92- 118 (31.55/14.28) SQQPTV..TSTTSFP..TPASSV.....GghfTGNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.40| 19| 21| 308| 326| 2
---------------------------------------------------------------------------
289- 307 (27.57/12.25) PEEEWQNQKV...YGKEIKVAE
308- 326 (31.16/14.59) PESSFLKQQL...KAMKLEPGT
328- 349 (28.66/12.96) PNHEFWEDALgheKPSKVAPGT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 149.58| 38| 39| 382| 419| 3
---------------------------------------------------------------------------
361- 386 (37.87/15.37) ...GQVRRPNQAN....G.AYP....SVSTPVAENTRP
387- 424 (64.81/30.77) KRTGKKRSYNDSSFVGYGEGFPDDDGDIDSGIYSNSEE
427- 458 (46.89/20.53) RGQGKKKRKKD.HISGVSPTLTERGGSYGVGMF.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.22| 18| 27| 135| 161| 4
---------------------------------------------------------------------------
135- 154 (24.03/33.12) RKDGGsFTSKESgSDFMDVD
165- 182 (33.19/13.96) RQKGG.FRGNLD.ENAMDLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.51| 24| 39| 211| 236| 5
---------------------------------------------------------------------------
188- 208 (19.31/ 7.08) ......STQEEQLSLSALqQDIG.TAFH
211- 236 (36.50/27.15) KSSYttSGPNPSLDLVSL.YGLG.PVAA
253- 274 (30.70/16.43) RKSY..EGKIKGL...CL.AGRNkPVKA
---------------------------------------------------------------------------
|