Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MTSISPDQLKVLEQTRQRLVQLTQSLASLINNINQSDPLPPWSSLQSQATIISNNLLNVSQQLTDHHDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGRAMGSAEATRLKTGLSEQQLAELWQWAPVEANMEARRRNWGGDYTLEEKEMGVRNVVTGLRRGLSEEESGSESGSEEEEGEEGEGEGDGEGMEVVGVQRRAGSGGVQFEISREGGHVPSAPVGAGMPLDDVFRFMMTGAMPRGR |
Length | 253 |
Position | Head |
Organism | Helicocarpus griseus UAMH5409 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Helicocarpus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.575 |
Instability index | 60.71 |
Isoelectric point | 4.73 |
Molecular weight | 27702.53 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15452 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.05| 23| 28| 83| 105| 1 --------------------------------------------------------------------------- 83- 105 (38.75/24.84) GRTEAAMLSQLLRTKLEPRVEDW 113- 135 (39.31/25.30) GSAEATRLKTGLSEQQLAELWQW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MPLDDVFRFMMTGAMPRG 2) VQFEISRE | 235 215 | 252 222 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab