<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15447
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MASISPEQLKVLEQTRQRLVQLTQSLASLINNINQSDPLPSWSSLQSQATIISNNLLNVSEQLTDHHDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGLSMGNADAARGRTGLTEEQLAELWQWAPVEANMEARRRNWGGDYTLEEKEMGVKNVVTGLRRRLDEEDSGSESGSGDEDESGEGEEGAGDGSGSGMEVVGVHRRPGGSGVQFDISREGGHVPPTPMSPALPLQDVFRFMMTGAAPRGR |
| Length | 257 |
| Position | Head |
| Organism | Blastomyces parvus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.586 |
| Instability index | 63.72 |
| Isoelectric point | 4.75 |
| Molecular weight | 27963.71 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15447
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.22| 13| 17| 175| 187| 1
---------------------------------------------------------------------------
175- 187 (24.63/10.65) EEDSGSESGSGDE
194- 206 (25.59/11.28) EEGAGDGSGSGME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.34| 23| 42| 83| 105| 2
---------------------------------------------------------------------------
83- 105 (40.68/23.49) GRTEA..AMLSQL..LRTKLEPRVEDW
123- 149 (34.66/19.16) GLTEEqlAELWQWapVEANMEARRRNW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.27| 23| 46| 4| 30| 3
---------------------------------------------------------------------------
4- 30 (31.49/27.63) ISPEQLKVLEQtrqrLVQLTQSLASLI
52- 74 (38.78/23.42) ISNNLLNVSEQ....LTDHHDLLSSLV
---------------------------------------------------------------------------
|