<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15447

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMASISPEQLKVLEQTRQRLVQLTQSLASLINNINQSDPLPSWSSLQSQATIISNNLLNVSEQLTDHHDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGLSMGNADAARGRTGLTEEQLAELWQWAPVEANMEARRRNWGGDYTLEEKEMGVKNVVTGLRRRLDEEDSGSESGSGDEDESGEGEEGAGDGSGSGMEVVGVHRRPGGSGVQFDISREGGHVPPTPMSPALPLQDVFRFMMTGAAPRGR
Length257
PositionHead
OrganismBlastomyces parvus
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
Aromaticity0.04
Grand average of hydropathy-0.586
Instability index63.72
Isoelectric point4.75
Molecular weight27963.71
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364144

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15447
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.22|      13|      17|     175|     187|       1
---------------------------------------------------------------------------
  175-  187 (24.63/10.65)	EEDSGSESGSGDE
  194-  206 (25.59/11.28)	EEGAGDGSGSGME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.34|      23|      42|      83|     105|       2
---------------------------------------------------------------------------
   83-  105 (40.68/23.49)	GRTEA..AMLSQL..LRTKLEPRVEDW
  123-  149 (34.66/19.16)	GLTEEqlAELWQWapVEANMEARRRNW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.27|      23|      46|       4|      30|       3
---------------------------------------------------------------------------
    4-   30 (31.49/27.63)	ISPEQLKVLEQtrqrLVQLTQSLASLI
   52-   74 (38.78/23.42)	ISNNLLNVSEQ....LTDHHDLLSSLV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15447 with Med8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NVVTGLRRRLDEEDSGSESGSGDEDESGEGEEGAGDGSGSGMEVVGVHRRPGGSGVQFDISREGGHVPPTPMSPALPLQDVFRFMMTGAAPRGR
164
257










Molecular Recognition Features






MoRF SequenceStartStop




1) ALPLQDVFRFMMTGAAPRGR
238
257