Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MESLNSRHQHLVPGRQSSFQNLALNNVRSGSRTGANFSVTSPFGNYAEPTSVNYRTTMVSTTSTPTPSTQMSPFYLLRDDTLTPLETNSNLLVKHGFDQTYQKSKKVKEGLSSFLPHLPGVLDELGGPENSLRSVVDKPPIGGKELLPLTGHSLSGFRLNPGPIPEQFRFMSQHPVKKKHKHKKHKSQDNERNKEGGEAVSQMGPEQEKLASSSTDKPESGHDSKKHKKQKKHDDGERKKKKKEKKKKKRHTPDATPPGGGLDPS |
Length | 265 |
Position | Head |
Organism | Stylophora pistillata (Smooth cauliflower coral) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia> Astrocoeniina> Pocilloporidae> Stylophora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.151 |
Instability index | 50.72 |
Isoelectric point | 9.88 |
Molecular weight | 29371.68 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15426 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.54| 21| 62| 177| 197| 1 --------------------------------------------------------------------------- 177- 197 (40.00/16.82) KKKHKHKKHKSQDNERNKEGG 241- 261 (35.54/14.26) KKKEKKKKKRHTPDATPPGGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ESGHDSKKHKKQKKHDDGERKKKKKEKKKKKRHTPDATPP 2) FMSQHPVKKKHKHKKH | 219 170 | 258 185 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab