| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MADDKVPERFELLEQTIEQFVETTRQIGIIVSDFQPGSQGVLNHKINSMIDNMREIEKCKAHVQDVEVPLEVFEYIDQGRNPQLYTKDCLEKALEKNQQVNGKIDAYKNFKSLLVDELSKHFPKEIDEYQNIKGPQMKS |
| Length | 139 |
| Position | Middle |
| Organism | Stylophora pistillata (Smooth cauliflower coral) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia> Astrocoeniina> Pocilloporidae> Stylophora. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.708 |
| Instability index | 29.61 |
| Isoelectric point | 5.01 |
| Molecular weight | 16157.16 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP15412
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 137.64| 41| 51| 43| 84| 1
---------------------------------------------------------------------------
43- 84 (67.31/46.68) NHKINSMIDNMREIEKCKAHVQDVEVPLEVFEYiDQGRNPQL
97- 137 (70.33/44.51) NQQVNGKIDAYKNFKSLLVDELSKHFPKEIDEY.QNIKGPQM
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HFPKEIDEYQN 2) KIDAYK 3) LYTKDCLEKALEKN | 121 103 84 | 131 108 97 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab