Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSQPSRILPQSKENLLKSYTKRLKDDVKSILDNFTEIIKSSKVEEEKQVSRLTQSAQDQYEVNVRAANIVRAGESLLKLVSDMKEFLMLNDFPSVNATISERSSTLQDMTNQTDQQLLNLKQELALNLYELEQSYYSSSYR |
Length | 141 |
Position | Head |
Organism | Stylophora pistillata (Smooth cauliflower coral) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia> Astrocoeniina> Pocilloporidae> Stylophora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.648 |
Instability index | 61.45 |
Isoelectric point | 5.28 |
Molecular weight | 16260.14 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15402 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KQVSRL 2) PSRILPQ 3) YTKRLK | 47 4 19 | 52 10 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab