<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15401
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAAEGVCPFPLPPTQYYKVYTDENVEKQLVPDPPTPAEGTYAMFGASFETDESIIRPLELQGITRLYTTQGRFDRIKELKKLNHSIVINFLELLDILIKSPSSPKREEKLEDLNLLFINIHHLINELRPHQARETLRVMMERQKQQRLDTADKLNKHLDRVVAMLQSSLSSLQLSARQQDSSFEKMEVDQSKEGSEEDEEFGREDEIMCSALENIS |
| Length | 216 |
| Position | Middle |
| Organism | Stylophora pistillata (Smooth cauliflower coral) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia>
Astrocoeniina> Pocilloporidae> Stylophora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.588 |
| Instability index | 57.09 |
| Isoelectric point | 4.95 |
| Molecular weight | 24892.97 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15401
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.42| 12| 46| 10| 21| 1
---------------------------------------------------------------------------
10- 21 (24.29/12.71) PLPPTQYYKVY........T
31- 50 (16.61/ 6.97) PDPPTPAEGTYamfgasfeT
57- 68 (19.52/ 9.14) PLELQGITRLY........T
---------------------------------------------------------------------------
|