Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAAEGVCPFPLPPTQYYKVYTDENVEKQLVPDPPTPAEGTYAMFGASFETDESIIRPLELQGITRLYTTQGRFDRIKELKKLNHSIVINFLELLDILIKSPSSPKREEKLEDLNLLFINIHHLINELRPHQARETLRVMMERQKQQRLDTADKLNKHLDRVVAMLQSSLSSLQLSARQQDSSFEKMEVDQSKEGSEEDEEFGREDEIMCSALENIS |
Length | 216 |
Position | Middle |
Organism | Stylophora pistillata (Smooth cauliflower coral) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Cnidaria> Anthozoa> Hexacorallia> Scleractinia> Astrocoeniina> Pocilloporidae> Stylophora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.588 |
Instability index | 57.09 |
Isoelectric point | 4.95 |
Molecular weight | 24892.97 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15401 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 60.42| 12| 46| 10| 21| 1 --------------------------------------------------------------------------- 10- 21 (24.29/12.71) PLPPTQYYKVY........T 31- 50 (16.61/ 6.97) PDPPTPAEGTYamfgasfeT 57- 68 (19.52/ 9.14) PLELQGITRLY........T --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKMEVD 2) QYYKVYT | 184 15 | 189 21 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab