| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MTSPKPPAASLTADEEPLYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLSYLRYWASPPYVKYLIYPGPTLQAGRGGDEGGGAVASRGLNRCHHGING |
| Length | 108 |
| Position | Middle |
| Organism | Ophiocordyceps unilateralis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.253 |
| Instability index | 51.48 |
| Isoelectric point | 6.82 |
| Molecular weight | 11792.17 |
| Publications | PubMed=26285697 PubMed=28970504 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP15395 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LTADEEPLYGGYSRFEI 2) PYVKYLIYP | 11 69 | 27 77 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab