<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15394

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMTANKMPLILDNAIPVDLNDVDDLFGDDVALSIPLKPQGKQLLGRLDELRSRGCCQSVAWSRLGTIASLTPDGQALQLRFLRCEPENGSWELSEPTTCEIKGTPAIPLVHLEWSAAISPDLAVIDAVGRVAIASFPISLNYPFITRKWDADAVDDSHAVVGSYWLPVAPSAQQKQPYNIIHGPAKKHGNTYQYETSFLHAGGSSHPHSSKSALLCVTMGGMLKMYWSQSNNKIEETVMELESVNSSDELVTHAALASDKRFLLVAIATCSFALKLLRLEIRWAGMGAPSDRSTLPQNVRLSPVLEKTHLASTSWLHSGPNETDQDASAAALSYLHVLPSILDNTGKSTVPPVIVAIRSRAAAESFQTAQSILDRWEVVEERQAVPTAFEQLGSRRKSISLDLPNTTGLRKLDTIVINKVVVGLQTIQFGKILLLTMSDGTVEYRDRFSFEEMFTTEDLTRVMNLRQVGWTFADSGPCQQVAFSPTQCSMMLLGEDGKLRWSKLHYPMGDVGNTMQEAHYVATIAGLAVTAASSLWYQSNYDDMLAVVQPLTSKKRFTQEWVSELIRILKIQVDYSEEVHHDTLMRNSPLQSCLSIMNSLGFRGDAHRRSFQSKLAWVNLNVRNVVVLITLASNTPVTVRDRMSPLDEHEVVDSLTGCVKWSLDLLSWLADSLFALLKDQNFTQRLAPQRFAELAAYLQERNEVSLHLILCSSSRSFLSALCRRVAHLDNLSNKAIEFYRRQAGASDQNGGGRLMHPQLQQAYLRMQQVTRASLINVAEFERLLNALASDIRQAYQTILPSRIKNGPNAPQGKQLEAAIKTAQVQFEVGALLTPSPPMAFLPALKKLFGNDLPAYRTLTDPAALFFSDFALLGILDDETSLAARKASGVYVDLFRKVKLKRGAAGPAWRRCARCTAVMEDVSVGKAGFTFILSQQRRCSCAGHWTLPVESKDTT
Length953
PositionTail
OrganismOphiocordyceps unilateralis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
Aromaticity0.07
Grand average of hydropathy-0.110
Instability index46.58
Isoelectric point7.29
Molecular weight105386.47
Publications
PubMed=26285697
PubMed=28970504

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15394
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     220.39|      75|     133|     130|     216|       1
---------------------------------------------------------------------------
  130-  158 (27.73/ 8.44)	...............................................................................................VAIASFPISLNYPFITRKWDA.DAVDDSHA
  169-  287 (82.58/71.64)	PSAQQKQPYNIIHGPAkkHGNTYQYETSFLHAGGSSHPHSSKSALLCVtmggmlkmywsqsnnkieetvmelesvnssdelvthaalasdkrfllVAIATCSFALKLLRLEIRWAGmGA......
  288-  331 (57.94/27.78)	PSDRSTLPQNVRLSPV..LEKTHLASTSWLHSGPNETDQDASAAAL...............................................................................
  332-  383 (52.15/25.93)	...........................SYLHVLPSILDNTGKSTVPPV........................................ivairsrAAAESFQTAQS...ILDRW...EVVEERQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.07|      27|      53|     585|     616|       2
---------------------------------------------------------------------------
  585-  616 (31.15/31.25)	RNSPLQScLSIMNSLgfRGdAHRRSFQsKLAW
  641-  667 (50.92/25.31)	RMSPLDE.HEVVDSL..TG.CVKWSLD.LLSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     134.86|      41|      65|     678|     720|       4
---------------------------------------------------------------------------
  678-  720 (64.59/53.28)	DQNFTQRLAPQRFAElaAYLQERNEVSLHLILCSSSRSFLSAL
  746-  786 (70.27/51.46)	DQNGGGRLMHPQLQQ..AYLRMQQVTRASLINVAEFERLLNAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.92|      25|     420|      53|      80|       5
---------------------------------------------------------------------------
   53-   79 (43.40/35.65)	GCCQSVAWSrlGTIASLTPDGQALQLR
  475-  499 (47.53/27.23)	GPCQQVAFS..PTQCSMMLLGEDGKLR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15394 with Med16 domain of Kingdom Fungi
Unable to open file!