<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15380

Description Uncharacterized protein (Fragment)
SequenceSSTTTLEAQIESLTDLHTRLQSLRHIPLALLKPPALSGIPSSSIPSFRPQFQQLTDIAQAIRSRPIQDALHTACDDLRQDPSDLNSNLRREKRKRRRLVAPESPQPYMPEPKRTTAFRLDTSAHEPLGNDTLIDYIRDYNQSHQSKLHIWAPTRFMAVPESLIILHFAIPDVLSAFLSLVCKQGSHFLAVETVSVFGPRESKTPQTQSEFTVFQYLTQQISKVLQFEMQPLQSIVELLEGYDGLFIERCTVCGRVLSAEGHIPPMVRTWANDDKETSGGKWEPRHVTCR
Length289
PositionTail
OrganismAmanita thiersii Skay4041
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Amanitaceae> Amanita.
Aromaticity0.07
Grand average of hydropathy-0.397
Instability index66.87
Isoelectric point7.13
Molecular weight32761.95
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.71|      18|     234|      10|      27|       1
---------------------------------------------------------------------------
   10-   27 (32.07/21.58)	IESLTDLHTRLQSLRHIP
   51-   65 (25.27/15.55)	FQQLTDI...AQAIRSRP
   70-   81 (16.37/ 7.64)	......LHTACDDLRQDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      63.76|      16|      17|     161|     176|       2
---------------------------------------------------------------------------
  147-  158 (16.02/ 7.36)	.......LHIWAPTRFMAV
  161-  176 (26.92/16.46)	SLII...LHFAIPDVLSAF
  178-  196 (20.83/11.38)	SLVCkqgSHFLAVETVSVF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15380 with Med27 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) ALHTACDDLRQDPSDLNSNLRREKRKRRRLVAPESPQPYMPEPKRTTAFRLDT
69
121

Molecular Recognition Features

MoRF SequenceStartStop
NANANA