<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15378
| Description |
Uncharacterized protein |
| Sequence | MEACLNVLTKQEASPCVEKEEVKVEVERFIDLARQMEAFFLQKRFLLSAMRPELLVKEDNNELKCELQRKEELLRRHYDKISQWQNLLADLQGHTVYNKCQQQSAQAPPAVQQAPAPQHVVQQSVQMQNSLAQGMFLAGGRGAYAGTPLQGPLAYLEKTATNIGRGASPEYGGSMTPP |
| Length | 178 |
| Position | Head |
| Organism | Heliothis virescens (Tobacco budworm moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Noctuoidea>
Noctuidae> Heliothinae> Heliothis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.506 |
| Instability index | 64.02 |
| Isoelectric point | 6.32 |
| Molecular weight | 19913.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15378
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.46| 17| 21| 127| 143| 2
---------------------------------------------------------------------------
127- 143 (31.69/20.08) MQNSLAQGMFLAG..GRGA
149- 167 (25.77/15.18) LQGPLAYLEKTATniGRGA
---------------------------------------------------------------------------
|