<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15377
Description |
Uncharacterized protein |
Sequence | MQRNLPQNKEALLKSYTTRLKEDVKSMLENFEEIIKLAKLENETQLNRMTQIEQDTFEMQVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQQECDQKLMSLRDDIAADLYDLEDEYFTSIYK |
Length | 138 |
Position | Head |
Organism | Heliothis virescens (Tobacco budworm moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Noctuoidea>
Noctuidae> Heliothinae> Heliothis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.623 |
Instability index | 39.71 |
Isoelectric point | 4.89 |
Molecular weight | 16249.36 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.41| 16| 39| 73| 88| 1
---------------------------------------------------------------------------
73- 88 (27.87/16.60) LMKLVSDIKQYLI.LND
114- 130 (23.54/13.22) LMSLRDDIAADLYdLED
---------------------------------------------------------------------------
|