<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15366
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSSETTQVSSLPLPPMQYINFYTDENVRRNRAPLPPRPIHDSYSMFGHTFNADDTIIRSLESQGFRRLYPMHFERRRELKKLNHSLLVNFLDLLDLLVHCPDSPKRAEKVEDLSLLFIHIHHLLNEFRPHQARETLRVMMELQKRQRVETATRFKKHLDKVQDILQSALQSLPDQNEIESNFKVPVEILEHMDCNTNDVSNQDPCYELDRIMCNVVDNMR |
| Length | 220 |
| Position | Middle |
| Organism | Heliothis virescens (Tobacco budworm moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Noctuoidea>
Noctuidae> Heliothinae> Heliothis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.615 |
| Instability index | 59.57 |
| Isoelectric point | 6.26 |
| Molecular weight | 26034.46 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15366
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.47| 20| 26| 90| 113| 1
---------------------------------------------------------------------------
90- 113 (26.19/23.84) FLDLLDLLVHCPdsPKRAEkvEDL
117- 136 (37.28/20.18) FIHIHHLLNEFR..PHQAR..ETL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.55| 22| 26| 21| 45| 2
---------------------------------------------------------------------------
21- 45 (37.69/28.08) FYTDENVRRNrapLPPRPIHDSYSM
50- 71 (38.86/20.89) FNADDTIIRS...LESQGFRRLYPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.78| 14| 18| 185| 198| 3
---------------------------------------------------------------------------
185- 198 (26.96/17.56) PVEILEHMDCNTND
204- 217 (27.82/18.32) PCYELDRIMCNVVD
---------------------------------------------------------------------------
|