<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15345

Description Mediator of RNA polymerase II transcription subunit 13 (Fragment)
SequenceMRRTKARSCKDAIQSVPRAAIQAGGGADVRALAFSVFSGARRLLQHHANGKSLTGFGTAADANLFLQAKDEKNRAPYALFSPAWVLAAPRALKEVAETWGTGAAEAGGVLFLAYCLSHDQRWLLAAASDARGELLDTAAINIHVPHRSRRRRSGPARRLGLTKLMDFTLGVMSQAAQPWRLVVGRVGRIGHGELKGWSWLLSRKHLVRASALLREMCGSCGVLYPAGAPCIVSACLVSTEPDSCLRLMADRFTPDERFSQASIQSHLHTPRDVTATHILVFPTSATTQSNQMPFEPPMANGEDSDMMFLNVDMGDEDMGEDNMTDLLIGDMFNNMWAAGSPRRTDDDP
Length348
PositionMiddle
OrganismHeliothis virescens (Tobacco budworm moth)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Noctuoidea> Noctuidae> Heliothinae> Heliothis.
Aromaticity0.07
Grand average of hydropathy-0.196
Instability index52.36
Isoelectric point8.50
Molecular weight37857.81
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.75|      44|     119|      84|     146|       2
---------------------------------------------------------------------------
   23-   68 (67.11/46.62)	AGGGADVRALAFSVFSGARRLLQHHANGKSltGFGTAADANLFLQA
  103-  146 (73.64/28.84)	AAEAGGVLFLAYCLSHDQRWLLAAASDARG..ELLDTAAINIHVPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.43|      13|      16|     301|     313|       3
---------------------------------------------------------------------------
  301-  313 (25.08/16.27)	GEDSDMMFLNVDM
  319-  331 (24.35/15.62)	GEDNMTDLLIGDM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15345 with Med13 domain of Kingdom Metazoa
Unable to open file!