Description | Mediator of RNA polymerase II transcription subunit 13 (Fragment) |
Sequence | MRRTKARSCKDAIQSVPRAAIQAGGGADVRALAFSVFSGARRLLQHHANGKSLTGFGTAADANLFLQAKDEKNRAPYALFSPAWVLAAPRALKEVAETWGTGAAEAGGVLFLAYCLSHDQRWLLAAASDARGELLDTAAINIHVPHRSRRRRSGPARRLGLTKLMDFTLGVMSQAAQPWRLVVGRVGRIGHGELKGWSWLLSRKHLVRASALLREMCGSCGVLYPAGAPCIVSACLVSTEPDSCLRLMADRFTPDERFSQASIQSHLHTPRDVTATHILVFPTSATTQSNQMPFEPPMANGEDSDMMFLNVDMGDEDMGEDNMTDLLIGDMFNNMWAAGSPRRTDDDP |
Length | 348 |
Position | Middle |
Organism | Heliothis virescens (Tobacco budworm moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Noctuoidea> Noctuidae> Heliothinae> Heliothis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.196 |
Instability index | 52.36 |
Isoelectric point | 8.50 |
Molecular weight | 37857.81 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364134 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15345 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 140.75| 44| 119| 84| 146| 2 --------------------------------------------------------------------------- 23- 68 (67.11/46.62) AGGGADVRALAFSVFSGARRLLQHHANGKSltGFGTAADANLFLQA 103- 146 (73.64/28.84) AAEAGGVLFLAYCLSHDQRWLLAAASDARG..ELLDTAAINIHVPH --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.43| 13| 16| 301| 313| 3 --------------------------------------------------------------------------- 301- 313 (25.08/16.27) GEDSDMMFLNVDM 319- 331 (24.35/15.62) GEDNMTDLLIGDM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DMMFLNVDMG 2) NMTDLLIGDMFNNMWAAGSPRRTDD | 305 322 | 314 346 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab