Description | Uncharacterized protein |
Sequence | MCNELPSFKVQQEKTNNIDESSPILEKFPTQPFTGKSSSSVHFLKNDARMADKQRQGVNKKMQVEEMKHRLKEGVKSLNENFLGIFRAAKIDSGNPQQQGGNHAMGQAGPRAATKEEMAARAALMISRISQSFDVSGVKVCDDLKTLTNEMREFFIVNDFAVVDSALRNAEAASVAKCEEMQEVYINLQVEVADLITKLDEEHNANYNYNC |
Length | 211 |
Position | Head |
Organism | Diploscapter pachys |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.569 |
Instability index | 39.06 |
Isoelectric point | 5.67 |
Molecular weight | 23595.40 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15315 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) FLGIFRAAKID 2) SPILEKFPTQPFT 3) SVHFLKNDAR | 82 22 40 | 92 34 49 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab