<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15312
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MPPGNYSGYPPHQQMNMNGPPGGHQYGPNATNLKTPKQEPVRSWDNNQQPHYYGSQQGGWGGGPAGGIPPMGAGSGYPPQSMNPTSIGNGSHNGGSSQPPSVLEALITHPQYPMHPNSRHNMPMGPMNGAPGSGPGMAKSGPPMGGQPTSGSNIQVTPGLVEMTPQEQQTYQRKLHELRPHCDNLRLRSQQCRIDGNHEAAHKLEVMLAVLEGRRVVTLEYLSHLESWIYKKQEFLAGASQLMQNGGLHAGGQGAAAGNASNSMMNPAMGDMNNSVPQGMPSNIPPTPHMSAPNNPYGTQGQPPMSHGGYMHSQQMPPMWNQGSHQQRMMPQDMMGGAPMGGVPSSAAGSMHYQRDDHHGHRAAPYPSPQMRQQMRQHSGSSGQPIRDHRGSVSSMSSMSGGAPTPTQSMATAQPPSIPGVDEIYNIEDFLPTPIESGGLQSSMQSGMHGQMSNATRPILNEAARREFSAMSDRFDADLQNVEFMDAQSVIVKSKLRSHTVPVLRVIVPAMYPNVNASIDRGTLDLDAYLYDDLQNQVHDRLSRVEQPTITNLLNTWEQTVTQFYQSQGGNPLDTFDEIFRNYDSF |
| Length | 586 |
| Position | Tail |
| Organism | Diploscapter pachys |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.768 |
| Instability index | 66.78 |
| Isoelectric point | 6.35 |
| Molecular weight | 63515.15 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15312
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
7| 452.18| 57| 57| 288| 344| 1
---------------------------------------------------------------------------
26- 69 (59.36/14.66) ...YGPNaTNL.KTPKQEP.VR..SWDNNQ....Q.PHYY....GSQQGG..........W......GGGP.....AGGI.P
84- 131 (67.80/17.75) P.TSIGN.GSHnGGSSQPPsVLEALITHPQ....Y..PMHPN..SRHN.............MP...MG..P.....MNGA.P
135- 175 (36.45/ 6.28) PGMAKSG.PPM.G..GQP...TSGSNIQVTpglvEMTPQ.EQ..QTYQRK..........L.....................
180- 215 (49.53/11.06) PHC...D.N...............LRLRSQ....QCRI...D..GNHEAA..........HKLEVML..AV.....LEGR.R
241- 281 (59.69/14.78) QLMQNGG.LHA.GGQGAAA.GNASNSMMNP....AMGDMNN.....S..............VPQGM...............P
288- 344 (122.04/37.61) PHMSAPN.NPY.GTQGQPP.MSHGGYMHSQ....QMPPMWNQ..GSHQQR..........MMPQDMMGGAP.....MGGV.P
351- 415 (57.29/13.90) MHYQR.D.DHH.GHRAAP.......Y.PSP....QMRQQMRQhsGSSGQPirdhrgsvssM..SSMSGGAPtptqsMATAqP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.89| 14| 65| 2| 16| 2
---------------------------------------------------------------------------
2- 16 (29.28/14.60) PPGNYSGYPPhQQMN
70- 83 (31.61/11.84) PMGAGSGYPP.QSMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 189.91| 50| 53| 430| 481| 3
---------------------------------------------------------------------------
430- 481 (82.17/56.13) FLPTpiESGGLQSSMQSGMHGQMSNATRP....ILN...EAARREFSAMS.....DRFDADLQN
484- 528 (62.44/36.06) FMDA..QSVIVKSKLRS..H......TVP....VLRvivPAMYPNVNASI.....DRGTLDLDA
530- 582 (45.30/23.55) ..........LYDDLQNQVHDRLSRVEQPtitnLLN.twEQTVTQFYQSQggnplDTFDEIFRN
---------------------------------------------------------------------------
|