Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MGDSPLNAGASSSGQTTGSLRTKISLKAGAATPSYTVVSPFYCMKQEVPPKSNVLGSTDLLGAYDLSSVYSRFCSTKKMREDLASFLPHIYGNFDFAQGQDTSSLRTLYEKPPITGKEISNVSPNHMNAFRLNVGTATSSTSGPRAKTD |
Length | 149 |
Position | Head |
Organism | Diploscapter pachys |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.398 |
Instability index | 44.40 |
Isoelectric point | 9.14 |
Molecular weight | 15882.63 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15298 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.64| 26| 82| 14| 40| 1 --------------------------------------------------------------------------- 14- 40 (40.77/27.12) GQTTGSLRTkISLKAGAATPSYTVVSP 99- 124 (46.87/27.20) GQDTSSLRT.LYEKPPITGKEISNVSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LRTLY 2) YGNFDF 3) YTVVSPFYC | 105 91 35 | 109 96 43 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab