<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15297
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MRLTAVRKLTSLSLSIHLALPSTLYLDSPEETKRRFEIECEFVQALCNPHYLNFLAQRGYFKEAYFINYLKYLLYWKKPEYAKCLKYPQCLFFLDLVQEPEFREAIASTAAAKFIEDQQILQWQYYLRQRQRLHENPDAAERQTVDTATTQEIGDEAIDYSDNEDSDGPSTHTNGTSKQNGVH |
Length | 183 |
Position | Middle |
Organism | Diploscapter pachys |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.594 |
Instability index | 47.69 |
Isoelectric point | 5.40 |
Molecular weight | 21416.81 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15297
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.22| 12| 19| 51| 68| 1
---------------------------------------------------------------------------
33- 44 (20.55/ 6.17) KRRFEIECEFVQ
57- 68 (21.66/23.27) QRGYFKEAYFIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.69| 12| 19| 70| 81| 4
---------------------------------------------------------------------------
70- 81 (23.38/12.33) LKYLLYWKKPEY
91- 102 (21.31/10.78) LFFLDLVQEPEF
---------------------------------------------------------------------------
|