<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15293
Description |
Uncharacterized protein |
Sequence | MVADALMNEMGKCVRDMFTNAHKDMKQLPEGKNLSEFRFEHICKFWLIAPLVRLCPQPANVPQQFHSTRQTFIDNLIP |
Length | 78 |
Position | Kinase |
Organism | Diploscapter pachys |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.268 |
Instability index | 44.58 |
Isoelectric point | 7.77 |
Molecular weight | 9088.57 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15293
No repeats found
No repeats found
|