| Description | Uncharacterized protein |
| Sequence | MAQQNPNVGRTAMAKKLVIEEYKRRLRDNIRSLNDNFVQILQATKISTDDNMHKVQSGRMTEYYTTKDEMSARAALMVRACDELHRLTNDLKEFLILHDFNYLSSAIQNAEGECDKNIEQQKQIHQNLKIEIANLISDIDRELTEHFQLRH |
| Length | 151 |
| Position | Head |
| Organism | Diploscapter pachys |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.719 |
| Instability index | 67.24 |
| Isoelectric point | 6.30 |
| Molecular weight | 17688.86 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP15291 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) GRMTEYYTTK 2) YKRRLRD | 58 22 | 67 28 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab