<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15274

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMNQSTNNLTATQAIAPYPNPPEYAQFYTNERLAQGDVPQPPPPFTEFRVFGEEYKLDDDVIRPLESAGIRQLYPAKYDWKEEMKKLNRSVIAAFLDLLDILIRCPDHSEREVKLTDIHTLFINMHHLINEYRPVQARDLIRLMQVDQIKELEEAVELFKTYMDDGRKALKEVMKVDTSRLTQPPKPKPSTLVTIDSDDEETSMPRTKPAQEDVEMLDDDSPASSVGQTHRRGPKPSLELAKHRHAIDLEFFNQL
Length254
PositionMiddle
OrganismDiploscapter pachys
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
Aromaticity0.07
Grand average of hydropathy-0.697
Instability index45.24
Isoelectric point5.10
Molecular weight29327.89
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. 


ECO:0000256	RuleBase:RU364060

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15274
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.70|      20|      28|     127|     146|       1
---------------------------------------------------------------------------
  127-  146 (33.87/22.07)	LINEYRPVQARDLIRLMQVD
  157-  176 (33.83/22.03)	LFKTYMDDGRKALKEVMKVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.42|      11|     157|      56|      68|       2
---------------------------------------------------------------------------
   56-   68 (16.46/16.90)	LDDDviRPLESAG
  216-  226 (20.96/13.55)	LDDD..SPASSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.21|      11|      21|      16|      26|       3
---------------------------------------------------------------------------
   16-   26 (23.94/ 9.79)	PYPNPPEYAQF
   40-   50 (23.26/ 9.36)	PPPPFTEFRVF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15274 with Med7 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VMKVDTSRLTQPPKPKPSTLVTIDSDDEETSMPRTKPAQEDVEMLDDDSPASSVGQTHRRGPKPSLELAKH
172
242










Molecular Recognition Features






MoRF SequenceStartStop




1) EYAQFYTNERLA
22
33