<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15274
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MNQSTNNLTATQAIAPYPNPPEYAQFYTNERLAQGDVPQPPPPFTEFRVFGEEYKLDDDVIRPLESAGIRQLYPAKYDWKEEMKKLNRSVIAAFLDLLDILIRCPDHSEREVKLTDIHTLFINMHHLINEYRPVQARDLIRLMQVDQIKELEEAVELFKTYMDDGRKALKEVMKVDTSRLTQPPKPKPSTLVTIDSDDEETSMPRTKPAQEDVEMLDDDSPASSVGQTHRRGPKPSLELAKHRHAIDLEFFNQL |
| Length | 254 |
| Position | Middle |
| Organism | Diploscapter pachys |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.697 |
| Instability index | 45.24 |
| Isoelectric point | 5.10 |
| Molecular weight | 29327.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15274
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.70| 20| 28| 127| 146| 1
---------------------------------------------------------------------------
127- 146 (33.87/22.07) LINEYRPVQARDLIRLMQVD
157- 176 (33.83/22.03) LFKTYMDDGRKALKEVMKVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.42| 11| 157| 56| 68| 2
---------------------------------------------------------------------------
56- 68 (16.46/16.90) LDDDviRPLESAG
216- 226 (20.96/13.55) LDDD..SPASSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.21| 11| 21| 16| 26| 3
---------------------------------------------------------------------------
16- 26 (23.94/ 9.79) PYPNPPEYAQF
40- 50 (23.26/ 9.36) PPPPFTEFRVF
---------------------------------------------------------------------------
|