<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15267
| Description |
Uncharacterized protein |
| Sequence | MLNDSFSVKQGFFFGSDQEMLNAAELLERNFGVQFPEELDGTIDLQTGSANCCKFNRWGTLVAVGATDGRIYIFDFLTRGIVKTWNAHSLPITSLSWSRDGRRLLTAAADNNLMVWDVLTATKIHSIKYHHMITFAMFNPRNDKHALVLQLNSSPPLLQVFENPPYQKAIVCDVPLLSNEDTVQCVSYDRKGRYIITGTNKGKLIIYDAKTLKMVNWVKQNSTQSIKQIFVPMKCNSVLTNTGDRVIRSYNFDDLINLSKCGKGTMVEAKYKVQDMVNKAAWRAVCTDSDGYYICGATTKSHSLYVWDGSSGALIKILHGTKGETLNDVQWHPTRPVILSIAAGIISVWTQAHVENWSAFAPDFTELDENVKYVEKEGEFDLQDEDADQEEKKQDQDLDVEIDVVHLKPEEMMCSSDEVGIELA |
| Length | 424 |
| Position | Tail |
| Organism | Diploscapter pachys |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Diploscapter.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.264 |
| Instability index | 29.71 |
| Isoelectric point | 5.22 |
| Molecular weight | 47733.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | Set1C/COMPASS complex GO:0048188 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15267
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.07| 15| 19| 243| 257| 1
---------------------------------------------------------------------------
243- 257 (26.72/19.67) GDRVIRSYNFDDLIN
264- 278 (26.35/19.30) GTMVEAKYKVQDMVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.31| 14| 19| 353| 370| 3
---------------------------------------------------------------------------
353- 370 (17.94/24.00) HVENWSAFapDFTelDEN
373- 386 (25.37/15.68) YVEKEGEF..DLQ..DED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.51| 16| 19| 289| 304| 4
---------------------------------------------------------------------------
289- 304 (29.95/25.08) SDGYYI.CGATTKSHSL
310- 326 (22.56/16.99) SSGALIkILHGTKGETL
---------------------------------------------------------------------------
|