<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15262

Description Uncharacterized protein
SequenceQIKNLKDQYFPELSELFNKISVKLQHVDNMIPPQKPSEQYDRMKNFKTMLGRILHMLQISKSSIQPAMRDKVPQYEKQIISILSSQRTKPVQPQIQQQFQPPAGQAPDSSILQQQQTSQNLQQHDSHTNPQASLSSKSTGLQSSGVTGIQHVPLPPTTNFSATTQHQAVSNLEAAQRGNFNSLQHGLVSGALQQGTMNTQLQTSGSMLSHNPISTMQASGNSMQPNASSLQQQQQDHHLMQSEQMKRQMYQYQQKQQMLQQQLPVQQQQQKQQQVQMQVPQLHAGNDVRQGTAMKPGIYQHHLSQRSNYYQQQLKQSGDFPISSPNLQASSPQISHHSPQIDKHNQLSSQIKTGTPLHSANSPFVPSPSPSIAPSPIPVDSDKPHSIISSLSNTGQTGHQQTSLAPQTKSMSLNTPGISASPLLAEFTSVDGSQANMPTQAPTKSNAAERPMDRLLKALRTTQRESLNAAVSDIRSVVSMMDRIAGSAPGNGSRAAVGEDLVAMTKCRLQARNFITNDGSGASKKMKRDTSAMPLNVSSTGSVDDSFKQTFSADTPDVQSTATSRANKRQKVEVNHALLEEIQAINQELIDTELNVCEEDADSFAAASEGTVIKCTYTPVAVSPSLKSMLASAQTSLIMPLRLLVPAGYPKCASPVILDKFPDEQRNSDDLSSKARSKFGVSLRGLAEPMSLREIARAWDASARGAIVECAQKTGGGSFSSSYGCWEACVGA
Length732
PositionTail
OrganismHordeum vulgare subsp. vulgare (Domesticated barley)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
Aromaticity0.04
Grand average of hydropathy-0.613
Instability index56.97
Isoelectric point9.08
Molecular weight79701.57
Publications
PubMed=23075845

Function

Annotated function
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15262
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     232.11|      34|      35|     301|     334|       1
---------------------------------------------------------------------------
   85-  111 (37.80/11.75)	...SQ..RTKPVQPQI...QQ..QF....Q.....P.........PAGQAPD.........SS................I
  190-  232 (32.77/ 9.25)	GALQQ..GT..MNTQL...QTSGSMlshnPI...STmqasgnsmqPN..ASS.........LQ................Q
  259-  298 (33.37/ 9.55)	..LQQ..QLPVQQQQQ...KQQ.QV....QM...QV.........PQLHAGNdvrqgtamkPG................I
  301-  334 (64.08/24.80)	HHLSQ..RSNYYQQQL...KQSGDF....PI...SS.........PNLQASS.........PQ................I
  336-  388 (30.02/ 7.89)	HHSPQidKHNQLSSQI...K.TGT.....PLhsaNS.........PFVPSPS.........PSiapspipvdsdkphsiI
  389-  422 (34.07/ 9.90)	SSLSN..TGQTGHQQTslaPQTKSM....SL...NT.........PGISA.S.........P..................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.00|      15|      26|     490|     504|       2
---------------------------------------------------------------------------
  490-  504 (25.22/18.27)	GNGSRAAVGEDLVAM
  519-  533 (25.78/18.85)	GSGASKKMKRDTSAM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.44|      20|      39|     123|     146|       3
---------------------------------------------------------------------------
  123-  142 (34.37/13.54)	QHDSHTNPQAS....LSSKSTGLQ
  150-  163 (18.17/ 7.37)	QH.VPLPPTTN....FSAT.....
  165-  188 (26.89/ 8.11)	QHQAVSNLEAAqrgnFNSLQHGLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.75|      27|      30|       7|      33|       5
---------------------------------------------------------------------------
    7-   33 (47.64/32.49)	DQY..FPELSELFNKISVKLQHVDNMIPP
   38-   66 (42.11/27.88)	EQYdrMKNFKTMLGRILHMLQISKSSIQP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15262 with Med15 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) ASPLLAEFTSVDGSQANMPTQAPTKSNAAERPMDRLLKALRTTQRESLNAAVSD
2) PVQPQIQQQFQPPAGQAPDSSILQQQQTSQNLQQHDSHTNPQASLSSKSTGLQSSGVTGIQHVPLPPTTNFSATTQHQAVSNLEAAQRGNFNSLQHGLVSGALQQGTMNTQLQTSGSMLSHNPISTMQASGNSMQPNASSLQQQQQDHHLMQSEQMKRQMYQYQQKQQMLQQQLPVQQQQQKQQQVQMQVPQLHAGNDVRQGTAMKPGIYQHHLSQRSNYYQQQLKQSGDFPISSPNLQASSPQISHHSPQIDKHNQLSSQIKTGTPLHSANSPFVPSPSPSIAPSPIPVDSDKPHSIISSLSNTGQTGHQQTSLAPQTKSMSLNTPGI
420
90
473
418

Molecular Recognition Features

MoRF SequenceStartStop
NANANA