<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15258
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | FHRESLIQTSDFPTVGRRRHTPRPAGRLHPSPAAMSSPVQRSSLERLHHVEKRIVQALELAGSVMEELGNSQGPRAEAVVGCCREFMLCMRVPLSSIHHPRPQIFSSHAHVLKTRGNGWICKNVKLCFSVALYALVAASISVV |
| Length | 143 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.091 |
| Instability index | 51.84 |
| Isoelectric point | 10.20 |
| Molecular weight | 15824.24 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15258
No repeats found
|