<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15236
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MVTCETFVQTKGVNVTGMWEDFLQIAIDQEILLCLSLVNSGQDSDSEMAGHEEHNNSEANLVLATTNGKQEPLKSDASGFLNPKSLEIYLLHMFHDNILRKVREKYRNIVRYQSPGQTAEPAGDECGLLGHFCMTVAHKIFSNKVQLELESVLSRVPYLHLQSLPTWHSRTSSWSLCLRIPPPILAADKPSDNGEPKYKSSRTQFNTKIVLKDVQISLFGEGSPSIAGSLTRKPSDGYLINNYNCDLEDLPTMVLQQVASQVINWLH |
Length | 267 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.297 |
Instability index | 49.08 |
Isoelectric point | 5.71 |
Molecular weight | 29871.61 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15236
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.51| 21| 46| 60| 81| 1
---------------------------------------------------------------------------
60- 81 (31.69/25.72) NLVLATTNGK.QEPlKSDASGFL
108- 129 (34.82/23.34) NIVRYQSPGQtAEP.AGDECGLL
---------------------------------------------------------------------------
|