Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | PNSSSAAVVAVAAAAAAASGNGVQGGTGGVPSKQNLAQVTGLIQKTLGLLHQLNLSVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQVPMEVVNLIDDGKNPDEFTKDVLNSCIAKNQITKGRTDAFKSLRKHLLEELEEAFPHDVEAYRQIRATSAAESKRLAQSQSALSNGDVKVKPEH |
Length | 186 |
Position | Middle |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.202 |
Instability index | 31.41 |
Isoelectric point | 6.51 |
Molecular weight | 19611.93 |
Publications | PubMed=23075845 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15232 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 63.27| 16| 16| 39| 54| 1 --------------------------------------------------------------------------- 22- 35 (17.69/ 7.88) ..GVQG.GTGGVPSKQN 39- 54 (25.92/14.13) VTGLIQ.KTLGLLHQLN 57- 73 (19.66/ 9.38) VSSFSSaSQLPLLQRLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAVVAVA 2) KVKPEH | 6 181 | 12 186 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab