Description | Uncharacterized protein |
Sequence | XXGGEGRQKSGGRRGEGSAMDIISQLQEQLNEIAMVSVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQAPPAPGAPPPAPLPPQAQPQPALDLDEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELHRVEVLFNEATDNCINLKKPD |
Length | 183 |
Position | Middle |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.582 |
Instability index | 61.88 |
Isoelectric point | 4.62 |
Molecular weight | 19395.56 |
Publications | PubMed=23075845 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP15215 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.34| 16| 25| 47| 71| 1 --------------------------------------------------------------------------- 48- 71 (26.08/22.04) APPvrlsnsyPDPLNPNPNPDgPA 82- 97 (36.26/10.59) APP.......PAPLPPQAQPQ.PA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.65| 24| 27| 127| 150| 2 --------------------------------------------------------------------------- 127- 150 (37.28/21.91) LSSEEDQLKRIQEL..QAENEVVGLE 155- 180 (33.37/19.06) LEAAELELHRVEVLfnEATDNCINLK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) CINLKKPD 2) LMVLLIKY | 38 1 | 45 8 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab