<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15215
| Description |
Uncharacterized protein |
| Sequence | XXGGEGRQKSGGRRGEGSAMDIISQLQEQLNEIAMVSVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPDGPASQPQAPPAPGAPPPAPLPPQAQPQPALDLDEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELHRVEVLFNEATDNCINLKKPD |
| Length | 183 |
| Position | Middle |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.582 |
| Instability index | 61.88 |
| Isoelectric point | 4.62 |
| Molecular weight | 19395.56 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15215
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.34| 16| 25| 47| 71| 1
---------------------------------------------------------------------------
48- 71 (26.08/22.04) APPvrlsnsyPDPLNPNPNPDgPA
82- 97 (36.26/10.59) APP.......PAPLPPQAQPQ.PA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.65| 24| 27| 127| 150| 2
---------------------------------------------------------------------------
127- 150 (37.28/21.91) LSSEEDQLKRIQEL..QAENEVVGLE
155- 180 (33.37/19.06) LEAAELELHRVEVLfnEATDNCINLK
---------------------------------------------------------------------------
|