<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15183

Description Uncharacterized protein
SequenceMILFFLITSIRGLSVTLYMCCLILMQARVLREFSPEEVTANIYTMVDVLLHHIQLELQRGHLVQDLLSKAITNLAFFVWTHELVPLDIVLLALIDRDDDPYALRLVISLLERPELQHRIKAFCSSRSPEHWLKNQPPKRAELQKALGNHLSWKDRYPTFFDDIAARLLPVIPLIIYRLIENDATDIADRVLAFYSTFLAFHPLRFTFVRDILAYFYGHLPSKLIVRILNVLGVSTKTPFSESFAQYLGSSNSSICPPPEYFANLLLGLVNNVIPPLSSKSKSNPADASGGRTNFSKPHASTQAGGNSNTDAQRAFYQNQDPGSYTQLVLETAAIEILSLSVPASQIVSSLVQLIAHVQAMLIQSNTGQGMSAGLGQNSGLPTSPSGAGAESAGASRANTSASGISANFVSRSGYSCQQLSVLMIQACGFLLAQLPPEFHMQLYSEAARIIKDCRWLSDSSRPVKELNSAVGYALLDPTWASQDSTSTAIGNIVALLHSFFSNLPQEWLESSHTVIKHLRPVTSVAMLRIAFRILGPLLPRLAFARPLFMKTLALLFNVLGDVFGKNSQASPHVPASEIGDIIDFLHHAVMYEGQGGPVQSTSKPKVEILTLCGKVVDMLRPDVQHLLSHLKTDPTSSIYAATHPKLVQQHPS
Length652
PositionTail
OrganismHordeum vulgare subsp. vulgare (Domesticated barley)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
Aromaticity0.08
Grand average of hydropathy0.125
Instability index43.91
Isoelectric point7.71
Molecular weight71708.88
Publications
PubMed=23075845

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15183
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.80|      15|      15|     231|     245|       1
---------------------------------------------------------------------------
  231-  245 (27.03/16.39)	LGVSTKT..PFSESFAQ
  247-  263 (22.77/12.58)	LGSSNSSicPPPEYFAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.09|      30|     533|      34|      64|       4
---------------------------------------------------------------------------
   34-   64 (48.80/37.06)	SPEEVTANIYTMVDVLLHHIQLELQRGHlVQ
  570-  599 (56.29/38.32)	SPHVPASEIGDIIDFLHHAVMYEGQGGP.VQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.86|      12|      15|      86|      98|       6
---------------------------------------------------------------------------
   86-   98 (14.72/15.51)	LDIVlLALIDRDD
  103-  114 (19.14/13.77)	LRLV.ISLLERPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.92|      14|      19|     184|     202|       8
---------------------------------------------------------------------------
  184-  198 (18.52/10.69)	TDIADrVLAFYSTFL
  206-  219 (25.40/20.06)	TFVRD.ILAYFYGHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.97|      21|      23|     519|     540|       9
---------------------------------------------------------------------------
  519-  540 (31.95/21.92)	RPVTsVAMLRIAFRILGPLLPR
  545-  565 (36.02/20.45)	RPLF.MKTLALLFNVLGDVFGK
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15183 with Med23 domain of Kingdom Viridiplantae

Unable to open file!