Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MCDKYITLWFEQEIQTTLREEIKSACEYRPFEKCDYSARIANEICCKKLEYVIEKMDAMQLNMEQSSDGV |
Length | 70 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.526 |
Instability index | 67.27 |
Isoelectric point | 4.61 |
Molecular weight | 8341.50 |
Publications | PubMed=23075845 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15138 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) ACEYRPFEKCDYSARI 2) DAMQL 3) EQSSDGV | 25 57 64 | 40 61 70 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab