| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | IFWGFVVNRLALALREIQTTLREEIKSACEYRPFEKCDYSARIANEICCKKLEYVIEKMDAMQLNMEQSSDGV |
| Length | 73 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.210 |
| Instability index | 56.14 |
| Isoelectric point | 5.08 |
| Molecular weight | 8539.82 |
| Publications | PubMed=23075845 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP15137 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ARIANEI 2) CEYRPFEKCDY 3) IEKMDAMQLNMEQSSDGV | 41 29 56 | 47 39 73 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab