<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15111
Description |
Uncharacterized protein |
Sequence | MWIRMHRMIFHGVSSSTSAESSAETGDAGADYWQEEIYQMVKMLKDQYFAELSLLFNKMCVKLQHVESIIPLPIPSEQYDKLKRFTMMVERILRMLQISKASIQPYMRYSVPENEKRIIEILNAARKITQPQVKP |
Length | 135 |
Position | Tail |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.300 |
Instability index | 56.54 |
Isoelectric point | 9.01 |
Molecular weight | 15857.44 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15111
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.60| 22| 23| 84| 105| 1
---------------------------------------------------------------------------
66- 81 (19.64/ 8.72) .....VE..SIIP.LPIPSEQYDK
84- 105 (36.21/20.69) RFTMMVE..RILRMLQISKASIQP
108- 131 (29.75/16.02) RYSVPENekRIIEILNAARKITQP
---------------------------------------------------------------------------
|