| Description | Uncharacterized protein |
| Sequence | MVKMLKDQYFAELSLLFNKMCVKLQHVESIIPLPIPSEQYDKLKRFTMMVERILRMLQISKASIQPYMRYSVPENEKRIIEILNAARKITQPQVKP |
| Length | 96 |
| Position | Tail |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.195 |
| Instability index | 58.86 |
| Isoelectric point | 9.76 |
| Molecular weight | 11409.63 |
| Publications | PubMed=23075845 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro transcription coactivator activity GO:0003713 IEA:InterPro |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP15109
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.60| 22| 23| 45| 66| 1
---------------------------------------------------------------------------
27- 42 (19.64/ 8.19) .....VE..SIIP.LPIPSEQYDK
45- 66 (36.21/19.48) RFTMMVE..RILRMLQISKASIQP
69- 92 (29.75/15.08) RYSVPENekRIIEILNAARKITQP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IQPYMRYSV 2) KRIIEILNAARKITQPQV | 64 77 | 72 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab