<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15069
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MMQHMPSPARLGVTASSPSLPPNQSPANPTSSPPQANPPSASAAAAAAGAGAAVPTLTTSPALLPLLPPLPRAQSLLHLISSLASNLFELSPNRAAWISSYRGSLPNFLASSSASAAPTPLPAPVSTTKEAMSMLTSLQTQLFETVAELQETLDLQDARAKLAREARAKDASLLAFAKKLREAHHVLDRLVDDYADYRRDPKRPRGAAAVDEPEPVSQGDFGASLHSKLKLDDILTYAHRISYTTFAPPEHGAGLPLRGALPPAPQDNELRMSQLYQFADLDVGVPKKPLETKEGLTAEMESMPLFELPEEEPPRPSMLPITVPPGWQKGLPALLPAFPMPPPGWKPGDPXXXPAVKPDEQRPSVPIPVGVQPMVPRAQEPIQVAAVNLEISSSSDEYSSDVGSSDEDDED |
| Length | 411 |
| Position | Middle |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.338 |
| Instability index | 62.78 |
| Isoelectric point | 4.96 |
| Molecular weight | 43395.65 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15069
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.72| 15| 49| 309| 325| 1
---------------------------------------------------------------------------
309- 325 (25.76/14.56) PEEEppRPSM.LPITVPP
358- 373 (24.97/ 8.35) PDEQ..RPSVpIPVGVQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.59| 43| 49| 18| 60| 2
---------------------------------------------------------------------------
17- 59 (75.70/29.25) SPS....LPP...NQSPANPTSS.PPQANPPSASAAAAAAGAGAAVPTLTT
60- 110 (56.89/20.18) SPAllplLPPlprAQSLLHLISSlASNLFELSPNRAAWISSYRGSLPNFLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.86| 26| 52| 171| 207| 8
---------------------------------------------------------------------------
171- 207 (36.10/43.97) ASL...LAFAKKLREAHHVldrlvddyaDYRR.DPkrP........RGA
223- 260 (30.75/15.93) ASLhskLKLDDILTYAHRI.........SYTTfAP..PehgaglplRGA
---------------------------------------------------------------------------
|