<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15068
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | HWIPQSAAPAAAMMQHMPSPARLGVTASSPSLPPNQSPANPTSSPPQANPPSASAAAAAAGAGAAVPTLTTSPALLPLLPPLPRAQSLLHLISSLASNLFELSPNRAAWISSYRGSLPNFLASSSASAAPTPLPAPVSTTKEAMSMLTSLQTQLFETVAELQETLDLQDARAKLAREARAKDASLLAFAKKLREAHHVLDRLVDDYADYRRDPKRPRGAAAVDEPEPVSQGDFGASLHSKLKLDDILTYAHRISYTTFAPPEHGAGLPLRGALPPAPQDNELRMSQLYQFADLDVGVPKKPLETKEGLTAEMESMPLFELPEEEPPRPSMLPITVPPGWQKGLPALLPAFPMPPPGWKPGDPIXXXXXXXXXXXXXXXXXXXLLSSLMNNDPVYQFLLGCNQWCQGPKSQYRSRL |
| Length | 415 |
| Position | Middle |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.274 |
| Instability index | 61.25 |
| Isoelectric point | 6.28 |
| Molecular weight | 42405.99 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15068
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.04| 15| 15| 328| 342| 1
---------------------------------------------------------------------------
328- 342 (30.32/11.84) PSMLPI..TVPPGWQKG
344- 360 (28.73/10.82) PALLPAfpMPPPGWKPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 334.55| 86| 216| 4| 105| 2
---------------------------------------------------------------------------
4- 56 (75.65/18.80) .................................................................................PQSAAPAAAMMQHMP.SPARLGVTASSP.SLPPNQS.PANPTSSP....PQANPPSASAA
70- 138 (100.74/40.64) TTSPALLPL...LPPLPRAQSLLHLISSLASNLfELS............................................PNRAAWISSYRGSLP.N....FLASSSA.SAAPTPL.PA..............PVS....
139- 266 (100.51/28.32) TTKEAM.SM...LTSL.QTQ.LFETVAELQETL.DLQdaraklarearakdasllafakklreahhvldrlvddyadyrrdPKRPRGAAAVDEPEPvSQGDFGASLHSKlKLDDILT.YAHRISYT....TFA.PPEHGAG
267- 326 (57.65/12.74) ......LPLrgaLPPAPQDNE....................................................................LRMSQLY.QFADLDVGVPKK.PLETKEGlTAEMESMPlfelPEEEPP.....
---------------------------------------------------------------------------
|