<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15010
Description |
Uncharacterized protein |
Sequence | MRCNLVVPSYFFSMHTIVLHLLLVSHHFSCLTCMSITVLLVMLSSKLLPEMEVEETTKREQLLSGITNLPVPSQMDFCLF |
Length | 80 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.692 |
Instability index | 60.70 |
Isoelectric point | 6.00 |
Molecular weight | 9144.92 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15010
No repeats found
No repeats found
|