<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15008
| Description |
Uncharacterized protein |
| Sequence | MDADGRLRRALAAFGGGDVWDLVDAALAVAAPADLRARRDGIVERLYAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGAGLESKILAIRDFLEDPDQSEEELVSLLQNLADMDITYKALQETDIGRHVNGLRKHPSGDVRQLVKLLVRKWKEIVDGWVRLHNSGGDGGNSILTDGDSPEKTQGKSYQNARVAYSSTIQTCRSTLMETGVLVVA |
| Length | 238 |
| Position | Unknown |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.309 |
| Instability index | 44.72 |
| Isoelectric point | 5.11 |
| Molecular weight | 20216.51 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15008
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.12| 10| 24| 153| 162| 1
---------------------------------------------------------------------------
153- 162 (20.12/14.25) VNG.LRKHPSG
179- 189 (15.00/ 9.16) VDGwVRLHNSG
---------------------------------------------------------------------------
|