<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15004
Description |
Uncharacterized protein |
Sequence | VHNMTLPISGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKVIYNYYLLPGTTNFLAAHFVGLLT |
Length | 212 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.189 |
Instability index | 33.80 |
Isoelectric point | 9.45 |
Molecular weight | 24545.66 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15004
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.28| 17| 17| 132| 148| 1
---------------------------------------------------------------------------
132- 148 (31.64/12.03) KDKDKDREHKKHKHRHK
152- 168 (30.35/11.28) KEKDKDKDKKKDKHHEK
169- 185 (26.28/ 8.90) KRKHEGTEDSADVHKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.54| 14| 18| 68| 85| 2
---------------------------------------------------------------------------
68- 85 (20.77/20.99) LVQNAYLRDKPayiqPFD
89- 102 (24.77/13.88) LGQAFQLRETA....PVD
---------------------------------------------------------------------------
|