<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15003
| Description |
Uncharacterized protein |
| Sequence | MELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHE |
| Length | 105 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.905 |
| Instability index | 34.36 |
| Isoelectric point | 9.54 |
| Molecular weight | 12460.98 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.48| 18| 19| 67| 85| 1
---------------------------------------------------------------------------
67- 85 (30.30/12.03) KKHKDKDKDREHKKHKHrH
87- 104 (33.19/10.42) DRSKEKDKDKDKKKDKH.H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.84| 15| 19| 6| 24| 2
---------------------------------------------------------------------------
6- 24 (22.84/26.13) LVQNAYLRDKPayiqPFDM
27- 41 (26.00/17.43) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|