<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15001
| Description |
Uncharacterized protein |
| Sequence | PWLYAMLVVHNMTLPISGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
| Length | 210 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.346 |
| Instability index | 38.56 |
| Isoelectric point | 9.45 |
| Molecular weight | 24309.36 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15001
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.41| 17| 17| 140| 156| 1
---------------------------------------------------------------------------
140- 156 (31.82/11.85) KDKDKDREHKKHKH.....RHK
160- 181 (23.50/ 6.96) KEKDKDKDKKKDKHhekkrKHE
182- 198 (26.08/ 8.48) GTEDSADVHKHKKS.....KHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.54| 14| 18| 76| 93| 2
---------------------------------------------------------------------------
76- 93 (20.77/25.25) LVQNAYLRDKPayiqPFD
97- 110 (24.77/16.82) LGQAFQLRETA....PVD
---------------------------------------------------------------------------
|