<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15000
Description |
Uncharacterized protein |
Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKVAAFSLCLKLQYLQVLLIT |
Length | 188 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.164 |
Instability index | 32.56 |
Isoelectric point | 9.33 |
Molecular weight | 21812.72 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.77| 19| 19| 131| 149| 1
---------------------------------------------------------------------------
131- 149 (36.66/16.26) KHKDKDKDREHKKHKHRHK
151- 169 (34.12/14.68) RSKEKDKDKDKKKDKHHEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.84| 15| 19| 69| 87| 2
---------------------------------------------------------------------------
69- 87 (22.84/25.25) LVQNAYLRDKPayiqPFDM
90- 104 (26.00/16.59) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|