<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14999
| Description |
Uncharacterized protein |
| Sequence | VHNMTLPISGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKLYFICPQIVQKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNG |
| Length | 210 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.357 |
| Instability index | 38.01 |
| Isoelectric point | 9.41 |
| Molecular weight | 24340.37 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14999
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.92| 18| 18| 131| 148| 1
---------------------------------------------------------------------------
131- 148 (33.67/13.08) HKDKDKDREHKKHKHRHK
151- 168 (31.25/11.64) SKEKDKDKDKKKDKHHEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.84| 15| 19| 68| 86| 4
---------------------------------------------------------------------------
68- 86 (22.84/25.31) LVQNAYLRDKPayiqPFDM
89- 103 (26.00/16.72) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|