<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14970
| Description |
Uncharacterized protein |
| Sequence | MLFLISLSWSDALQFSCPVLLFLMHTVVLHLLLVSHHFSCLTCMSIAVLLVMLSSKLLPEMEVEETTKREPLLSGITNLPVPFCLVLLVE |
| Length | 90 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 1.140 |
| Instability index | 61.96 |
| Isoelectric point | 5.39 |
| Molecular weight | 10096.22 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14970
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.02| 16| 17| 21| 36| 1
---------------------------------------------------------------------------
21- 36 (27.43/14.55) LFLMHTVVLHLLLVSH
41- 56 (26.59/13.90) LTCMSIAVLLVMLSSK
---------------------------------------------------------------------------
|