| Description | Uncharacterized protein |
| Sequence | MHTVVLHLLLVSHHFSCLTCMSIAVLLVMLSSKLLPEMEVEETTKREQLLSRITNLRVPSQMEFCLFLLVE |
| Length | 71 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.693 |
| Instability index | 66.22 |
| Isoelectric point | 6.03 |
| Molecular weight | 8182.82 |
| Publications | PubMed=23075845 |
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP14969 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FLLVE 2) LLSRITNLRVPS | 67 49 | 71 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab