Description | Uncharacterized protein |
Sequence | MHTVVLHLLLVSHHFSCLTCMSIAVLLVMLSSKLLPEMEVEETTKREQLLSRITNLRVPSQMEFCLFLLVE |
Length | 71 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum. |
Aromaticity | 0.04 |
Grand average of hydropathy | 0.693 |
Instability index | 66.22 |
Isoelectric point | 6.03 |
Molecular weight | 8182.82 |
Publications | PubMed=23075845 |
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP14969 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) FLLVE 2) LLSRITNLRVPS | 67 49 | 71 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab