<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14964
| Description |
Uncharacterized protein |
| Sequence | MLFLISLSWSDALQFSCPVLLFLMHTVLHLLLVSHHFSCLTCMSIAVLLVMLSSKLLPEMQVEETTKRERLLSGITNLHVPSQMELCLFLLVE |
| Length | 93 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.942 |
| Instability index | 54.52 |
| Isoelectric point | 5.88 |
| Molecular weight | 10584.74 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14964
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.95| 17| 19| 2| 20| 1
---------------------------------------------------------------------------
1- 17 (32.18/19.89) MLFLISLSWSDAL...QFSC
20- 39 (26.77/ 9.45) LLFLMHTVLHLLLvshHFSC
---------------------------------------------------------------------------
|