<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14958
Description |
Uncharacterized protein |
Sequence | MDKSLALLLPPVHRPYHQISSIGSDHQEAYHIGCSSYDA |
Length | 39 |
Position | Tail |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.354 |
Instability index | 65.80 |
Isoelectric point | 5.97 |
Molecular weight | 4337.80 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14958
No repeats found
No repeats found
|