<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14954
| Description |
Uncharacterized protein |
| Sequence | MPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHLEDEVLNHLHDGESGIAKRQRMPAGNGELEEKTLSEILKNLENEVPNMKVSMYRRLDWSKRASSLASLMDDDFVDPSKELNLQNMGKSRPGSVTTPIDQVAVIELLVPSIFRVVVSLHPAGSVDPDAVAFFSPTEGGSYLHARGLSVHHVFKHVTEHADKALQYFISVEPSKALSLLLRWIADYQTLFTKLCSKCRRLLLMDKSLALLLPPVHRPYHQISSIGSDHQEAYHIGCSSYDA |
| Length | 287 |
| Position | Tail |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.214 |
| Instability index | 47.05 |
| Isoelectric point | 7.23 |
| Molecular weight | 31982.29 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14954
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.34| 19| 100| 153| 174| 5
---------------------------------------------------------------------------
153- 174 (29.41/28.32) LLVPSIFRvvvSLHPAGSVDPD
255- 273 (35.93/25.40) LLLPPVHR...PYHQISSIGSD
---------------------------------------------------------------------------
|