<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14882
Description |
ATP-dependent DNA helicase |
Sequence | QHLGVLKQKFPETPVLALTATATASVKEDVVQALGLANCVVFKQSFNRPNLRYFVMPKTKKCLEDIDRFIRENHHKECGIIYCLSRMDCEKVAEKLREYGHQASHYHGNMEPFDRTQVQRLWSMDKINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYNYSDYIRVKHMITQGSAEQVRSSSSSSHGQALATHKENLLCMVSYCENDVDCRRLLQLIHFGETFDPSHCAKTCDNCKKGLRWIEKDVTNIAKQLVELVLATGQPCSSSHILEVYRGSLNQNVKKNRHDMLPLHGAGKHLAKGEAARVLRNLVTEGILAEDVKKSDTYGSVSSVLKVNQVKVGGLRSGNQIVLKFPTPDKAPKMGKLDESSISQVNKPVQRQSEMDEVVGH |
Length | 411 |
Position | Unknown |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.428 |
Instability index | 45.74 |
Isoelectric point | 8.97 |
Molecular weight | 46131.43 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | 3'-5' DNA helicase activity GO:0043138 IEA:InterPro
ATP binding GO:0005524 IEA:UniProtKB-KW
hydrolase activity GO:0016787 IEA:UniProtKB-KW
|
GO - Biological Process | DNA recombination GO:0006310 IEA:InterPro
DNA repair GO:0006281 IEA:InterPro
DNA replication GO:0006260 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 114.92| 42| 139| 75| 143| 1
---------------------------------------------------------------------------
39- 106 (63.83/31.96) C..VVFKQSFNRPnlryfvmpktkkcledidrfirenhHKE...CGIIYCLSRMDCEKVAeKLREYGHQASHY
131- 165 ( 5.04/35.02) CatVAFGMGINKP........dvrfvihhslpksiegyHQE...CG...........................
215- 248 (46.05/17.89) ......................................HKEnllCMVSYCENDVDCRRLL.QLIHFGETFDPS
---------------------------------------------------------------------------
|